Noxiustoxin
Noxiustoxin is a toxin from the venom of the Mexican scorpion Centruroides noxius Hoffmann which block voltage-dependent potassium channels and calcium-activated potassium channels.
| Synonyms | NTx; NXT; NXT-1; Toxin II.11; Potassium channel toxin alpha-KTx 2.1. |
| Organism | Centruroides noxius Hoffmann |
| CAS Number | 85205-49-8 |
| Protein Data Bank | 1SXM |
| UniProt ID | P08815 |
| Molar Mass | 4195.06 |
| Chemical Formula | C174H286N52O54S7 |
| Amino Acid Sequence | TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN-NH2 |
Chemistry
NTX is a peptide consisting of 39 amino acid residues. It has a molar mass of 4195.06 and the following primary amino acid sequence: TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN-NH2. The sequence of NTX contains no histidine, arginine, tryptophan, or phenylalanine. NTX has three disulfide bridges and contains an amidated C-terminus. NTX is similar in sequence to the margatoxin, the kaliotoxin, the charybdotoxin, and the iberiotoxin. The three-dimensional solution structure of NTX has been solved by nuclear magnetic resonance.Target
NTX blocks the pore of several types of voltage-gated K+ channels by reversibly binding to the channel receptor site. Furthermore, it affects calcium-activated potassium channels of skeletal muscles. In the squid axon, NTX was found to have relatively low binding affinity with their target site on the channel protein.Mode of action
NTX associates reversibly with K+ channels and thus decreases K+ permeability in brain synaptosomeFurthermore, the mode of action of NTX is thought to be concentration dependent. K+ currents are found to be blocked by NTX at concentrations lower than 1.5 μM in a voltage-independent manner and above 1.5 μM in a voltage-dependent manner. The blocking of K+ channels by NTX is never complete, which indicates that NTX is either not able to fully block a channel or that not all channels have a receptor site for NTX.