ImKTX58
ImKTX58 is a peptide toxin from the venom of the scorpion species Isometrus maculatus. It is known for its selective inhibition of Kv1.3 channels, on which it acts as a pore-blocker.
Etymology
The name of ImKTX58 stems from its origin in the scorpion species Isometrus maculatus, its action on potassium channels, its categorization as a toxin, and its identification as the 58th clone in the Isometrus maculatus cDNA library. The protein is also referred to as kappa-Buthitoxin-Im1a, in line with the rational nomenclature system used for toxins produced by venomous species.Chemistry
Structure
The entire cDNA of ImKTX58 comprises 404 base pairs and codes for a 60 amino acid precursor, including a signal peptide of 22 amino acids. The mature ImKTX58 protein consists of 38 amino acid residues and has a molecular mass of 4370.14 Da. It features an α-helix at the N-terminus and β-sheet framework at the C-terminus reinforced by cysteine residues and three disulfide bridges, which contribute to its stability.Amino acid sequence of the mature protein: QVHTKIMCSVSRECYEPCHGVTGRAHGKCMNKKCTCYW.
Family and homology
ImKTX58 is a small polypeptide toxin from the α-KTX subfamily. It shares sequence homology with other potassium channel blockers from the same subfamily, such as LmKTx10 and ImKTX88.Target and channel specificity
ImKTX58 is a potent selective blocker of the Kv1.3 channel, which is a voltage-gated potassium channel essential in regulating neuronal excitability, and in the activation and proliferation of effector memory T cells. Electrophysiological recordings show that ImKTX58 effectively inhibits Kv1.3-mediated currents in Jurkat T cells and HEK293T cells.Moreover, ImKTX58 demonstrates a high selectivity for the Kv1.3 channel over other voltage-gated potassium channels, such as Kv1.1, Kv1.2, Kv1.5, as well as calcium-activated potassium channels SK2, SK3, BK, and voltage-gated sodium channels Nav1.4, Nav1.5, Nav1.7.