GTx1-15


GTx1-15 is a toxin from the Chilean tarantula venom that acts as both a voltage-gated calcium channel blocker and a voltage-gated sodium channel blocker.

Chemistry

Sequence

GTx1-15 is composed of 34 amino acid residues; its sequence has been determined to be DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCQYVF. This peptide has a molecular weight of approximately 4 kDa and is amidated at its carboxy terminus.

Structure and Family

GTx1-15 belongs to the GTx1 family, which consists of long loop inhibitor cystine knot motif toxins. The GTx1-15 peptide has a conserved structure of six cysteine residues with the characteristic ICK motif, which results in proteolytic, thermal, and chemical stability.

Homology

GTx1-15 displays sequence homology with other ion channel toxins from several spider species. It is homologous in sequence with sodium channel blocker PaurTx3 by 76.5%, and it also shares similarities in sequence with HnTx-IV, CcoTx2, TLTx1, ω-GrTx SIA, GsAFII and GsMTx2.

Target and Mode of Action

GTx1-15 targets low-voltage activated cation channels. It specifically inhibits:
The mode of action of GTx1-15 has not yet been clarified.

IC50

The effectiveness of GTx1-15 as a blocker of human cloned Nav and Cav channels is summarized below:
ChannelsIC50
Cav3.10.01 μM
Nav1.70.007 μM
Nav1.30.12 ± 0.06 μM
Nav1.5No significant effect
Nav1.8No significant effect